Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 4 |
---|
Ligand | BDBM50384775 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_821035 (CHEMBL2039222) |
---|
IC50 | 16±n/a nM |
---|
Citation | Turner, EM; Blazer, LL; Neubig, RR; Husbands, SM Small Molecule Inhibitors of Regulator of G Protein Signalling (RGS) Proteins. ACS Med Chem Lett3:146-150 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Regulator of G-protein signaling 4 |
---|
Name: | Regulator of G-protein signaling 4 |
Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
Type: | Enzyme |
Mol. Mass.: | 23263.51 |
Organism: | Homo sapiens (Human) |
Description: | P49798 |
Residue: | 205 |
Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
BDBM50384775 |
---|
n/a |
---|
Name | BDBM50384775 |
Synonyms: | CHEMBL2037227 |
Type | Small organic molecule |
Emp. Form. | C15H11FN2O2S |
Mol. Mass. | 302.323 |
SMILES | Fc1ccc(Cn2c(=O)sn(-c3ccccc3)c2=O)cc1 |
Structure |
|