Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM50385146 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_823084 (CHEMBL2039155) |
---|
IC50 | 1480±n/a nM |
---|
Citation | Trujillo, JI; Kiefer, JR; Huang, W; Day, JE; Moon, J; Jerome, GM; Bono, CP; Kornmeier, CM; Williams, ML; Kuhn, C; Rennie, GR; Wynn, TA; Carron, CP; Thorarensen, A Investigation of the binding pocket of human hematopoietic prostaglandin (PG) D2 synthase (hH-PGDS): a tale of two waters. Bioorg Med Chem Lett22:3795-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM50385146 |
---|
n/a |
---|
Name | BDBM50385146 |
Synonyms: | CHEMBL2035655 |
Type | Small organic molecule |
Emp. Form. | C24H26N2O3 |
Mol. Mass. | 390.4748 |
SMILES | OCc1ccc2ccccc2c1-c1ccc(cc1)C(=O)NCCN1CCOCC1 |
Structure |
|