Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor
LigandBDBM50385314
Substrate/Competitorn/a
Meas. Tech.ChEMBL_822689
Ki 3.4±n/a nM
Citation Bell IMStump CAGallicchio SNStaas DDZartman CBMoore ELSain NUrban MBruno JGCalamari AKemmerer ALMosser SDFandozzi CWhite RBZrada MMSelnick HGGraham SLVacca JPKane SASalvatore CA MK-8825: a potent and selective CGRP receptor antagonist with good oral activity in rats. Bioorg Med Chem Lett 22:3941-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor
Name:Calcitonin-gene-related peptide receptor; CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53330.91
Organism:Rattus norvegicus
Description:ChEMBL_1457286
Residue:464
Sequence:
MMDKKCTLCFLFLLLLNMALIAAESEEGANQTDLGVTRNKIMTAQYECYQKIMQDPIQQG
EGLYCNRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGNWFRHPDSNRT
WTNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNL
FFSFVCNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKV
AEEVYDYVMHILMHYQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSAS
YTVSTISDVQGYSHDCPTEHLNGKSIQDIENVALKPEKMYDLVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385314
n/a
NameBDBM50385314
Synonyms:CHEMBL2035981
TypeSmall organic molecule
Emp. Form.C32H31F2N5O3
Mol. Mass.571.617
SMILESC[C@]1(CNC2(CCCC2)C(=O)N1CC(=O)Nc1ccc2C[C@]3(Cc2c1)C(=O)Nc1ncccc31)c1cc(F)cc(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: