Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-lipoxygenase/FLAP
LigandBDBM50385380
Substrate/Competitorn/a
Meas. Tech.ChEMBL_822749
IC50 160±n/a nM
Citation Banoglu EÇaliskan BLuderer SEren GÖzkan YAltenhofen WWeinigel CBarz DGerstmeier JPergola CWerz O Identification of novel benzimidazole derivatives as inhibitors of leukotriene biosynthesis by virtual screening targeting 5-lipoxygenase-activating protein (FLAP). Bioorg Med Chem 20:3728-41 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-lipoxygenase/FLAP
Name:5-lipoxygenase/FLAP
Synonyms:5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein
Type:Enzyme
Mol. Mass.:18159.90
Organism:Homo sapiens (Human)
Description:P20292
Residue:161
Sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385380
n/a
NameBDBM50385380
Synonyms:CHEMBL2036382
TypeSmall organic molecule
Emp. Form.C26H26Cl2N2
Mol. Mass.437.404
SMILESCC(C)Cc1ccc(cc1)C(C)c1nc2cc(Cl)ccc2n1Cc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: