| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-lipoxygenase/FLAP |
|---|
| Ligand | BDBM50385380 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_822749 |
|---|
| IC50 | 160±n/a nM |
|---|
| Citation |  Banoglu E; Çaliskan B; Luderer S; Eren G; Özkan Y; Altenhofen W; Weinigel C; Barz D; Gerstmeier J; Pergola C; Werz O Identification of novel benzimidazole derivatives as inhibitors of leukotriene biosynthesis by virtual screening targeting 5-lipoxygenase-activating protein (FLAP). Bioorg Med Chem 20:3728-41 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-lipoxygenase/FLAP |
|---|
| Name: | 5-lipoxygenase/FLAP |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50385380 |
|---|
| n/a |
|---|
| Name | BDBM50385380 |
|---|
| Synonyms: | CHEMBL2036382 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26Cl2N2 |
|---|
| Mol. Mass. | 437.404 |
|---|
| SMILES | CC(C)Cc1ccc(cc1)C(C)c1nc2cc(Cl)ccc2n1Cc1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
