| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM22334 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_822749 (CHEMBL2040233) |
|---|
| IC50 | 110±n/a nM |
|---|
| Citation |  Banoglu, E; Çaliskan, B; Luderer, S; Eren, G; Özkan, Y; Altenhofen, W; Weinigel, C; Barz, D; Gerstmeier, J; Pergola, C; Werz, O Identification of novel benzimidazole derivatives as inhibitors of leukotriene biosynthesis by virtual screening targeting 5-lipoxygenase-activating protein (FLAP). Bioorg Med Chem20:3728-41 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM22334 |
|---|
| n/a |
|---|
| Name | BDBM22334 |
|---|
| Synonyms: | BW A4C | BW4C | BWA4C | BWA4C, 10 | CHEMBL314360 | JMC515449 Compound 7 | N-(3-phenoxycinnamyl)acetohydroxamic acid | N-hydroxy-N-[(2E)-3-(3-phenoxyphenyl)prop-2-en-1-yl]acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17NO3 |
|---|
| Mol. Mass. | 283.3218 |
|---|
| SMILES | CC(=O)N(O)C\C=C\c1cccc(Oc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
