| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM21599 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_825949 (CHEMBL2044973) |
|---|
| Ki | 3.8±n/a nM |
|---|
| Citation |  Crosignani, S; Jorand-Lebrun, C; Page, P; Campbell, G; Colovray, V; Missotten, M; Humbert, Y; Cleva, C; Arrighi, JF; Gaudet, M; Johnson, Z; Ferro, P; Chollet, A Optimization of the Central Core of Indolinone-Acetic Acid-Based CRTH2 (DP2) Receptor Antagonists. ACS Med Chem Lett2:644-649 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM21599 |
|---|
| n/a |
|---|
| Name | BDBM21599 |
|---|
| Synonyms: | 2-{5-chloro-1'-[(3-methyl-5-phenyl-1,2-oxazol-4-yl)methyl]-1,2-dihydrospiro[indole-3,3'-pyrrolidine]-2,5'-dione}acetic acid | Spiro-indolinone analogue, 91 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H20ClN3O5 |
|---|
| Mol. Mass. | 465.886 |
|---|
| SMILES | Cc1noc(c1CN1CC2(CC1=O)C(=O)N(CC(O)=O)c1ccc(Cl)cc21)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
