Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1/M5 chimeric protein
LigandBDBM50385679
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826082
Ki 1.7±n/a nM
Citation Del Bello FBarocelli EBertoni SBonifazi ACamalli MCampi GGiannella MMatucci RNesi MPigini MQuaglia WPiergentili A 1,4-dioxane, a suitable scaffold for the development of novel M3 muscarinic receptor antagonists. J Med Chem 55:1783-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1/M5 chimeric protein
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385679
n/a
NameBDBM50385679
Synonyms:CHEMBL2042405
TypeSmall organic molecule
Emp. Form.C20H26NO2
Mol. Mass.312.4254
SMILESC[N+](C)(C)C[C@H]1COCC(O1)(c1ccccc1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: