Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 3
LigandBDBM50385812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_823545
IC50 7.2±n/a nM
Citation Vachal PMiao SPierce JMGuiadeen DColandrea VJWyvratt MJSalowe SPSonatore LMMilligan JAHajdu RGollapudi AKeohane CALingham RBMandala SMDeMartino JATong XWolff MSteinhuebel DKieczykowski GRFleitz FJChapman KAthanasopoulos JAdam GAkyuz CDJena DKLusen JWMeng JStein BDXia LSherer ECHale JJ 1,3,8-Triazaspiro[4.5]decane-2,4-diones as efficacious pan-inhibitors of hypoxia-inducible factor prolyl hydroxylase 1-3 (HIF PHD1-3) for the treatment of anemia. J Med Chem 55:2945-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 3
Name:Egl nine homolog 3
Synonyms:Egl nine homolog 3 (EGLIN3) | Egl nine homolog 3 (EGLN3)
Type:Protein
Mol. Mass.:27265.54
Organism:Homo sapiens (Human)
Description:Q9H6Z9
Residue:239
Sequence:
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385812
n/a
NameBDBM50385812
Synonyms:CHEMBL2043011
TypeSmall organic molecule
Emp. Form.C31H28N6O5
Mol. Mass.564.5912
SMILESCc1cccnc1CN1CCC2(CC1)N(C(=O)N(C2=O)c1ccc(cc1)-c1ccc(cc1)C(O)=O)c1cc(=O)[nH]cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: