Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHypoxia-inducible factor prolyl hydroxylase 1
LigandBDBM50385794
Substrate/Competitorn/a
Meas. Tech.ChEMBL_823544
IC50 1.6±n/a nM
Citation Vachal PMiao SPierce JMGuiadeen DColandrea VJWyvratt MJSalowe SPSonatore LMMilligan JAHajdu RGollapudi AKeohane CALingham RBMandala SMDeMartino JATong XWolff MSteinhuebel DKieczykowski GRFleitz FJChapman KAthanasopoulos JAdam GAkyuz CDJena DKLusen JWMeng JStein BDXia LSherer ECHale JJ 1,3,8-Triazaspiro[4.5]decane-2,4-diones as efficacious pan-inhibitors of hypoxia-inducible factor prolyl hydroxylase 1-3 (HIF PHD1-3) for the treatment of anemia. J Med Chem 55:2945-59 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hypoxia-inducible factor prolyl hydroxylase 1
Name:Hypoxia-inducible factor prolyl hydroxylase
Synonyms:Egl nine homolog 2 | Estrogen-induced tag 6 | HIF prolyl hydroxylase | HIF-PH1 | HIF-prolyl hydroxylase 1 | HPH-3 | PHD1 | Prolyl hydroxylase domain-containing protein 1 | Prolyl hydroxylase domain-containing protein 1 (PHD1)
Type:Protein
Mol. Mass.:43657.01
Organism:Homo sapiens (Human)
Description:Q96KS0
Residue:407
Sequence:
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50385794
n/a
NameBDBM50385794
Synonyms:CHEMBL2041181
TypeSmall organic molecule
Emp. Form.C32H31N7O5
Mol. Mass.593.6324
SMILESCOc1cc(ncn1)N1C(=O)N(C(=O)C11CCN(Cc2ncccc2C)CC1)c1ccc(nc1)-c1ccc(cc1C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: