Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine/alpha-aminoadipate aminotransferase
LigandBDBM50386303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826599
IC50 631±n/a nM
Citation Dounay ABAnderson MBechle BMCampbell BMClaffey MMEvdokimov AEvrard EFonseca KRGan XGhosh SHayward MMHorner WKim JYMcAllister LAPandit JParadis VParikh VDReese MRRong SSalafia MASchuyten KStrick CATuttle JBValentine JWang HZawadzke LEVerhoest PR Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia. ACS Med Chem Lett 3:187-192 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine/alpha-aminoadipate aminotransferase
Name:Kynurenine/alpha-aminoadipate aminotransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47788.12
Organism:Rattus norvegicus
Description:ChEMBL_826599
Residue:425
Sequence:
MNYSRFLTATSLARKTSPIRATVEIMSRAPKDIISLAPGSPNPKVFPFKSAVFTVENGST
IRFEGEMFQRALQYSSSYGIPELLSWLKQLQIKLHNPPTVNYSPNEGQMDLCITSGCQDG
LCKVFEMLINPGDTVLVNEPLYSGALFAMKPLGCNFISVPSDDCGIIPEGLKKVLSQWKP
EDSKDPTKRTPKFLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTK
PWEPTFLSMDVDGRVIRADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQ
LMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKV
NGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQL
IKDVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386303
n/a
NameBDBM50386303
Synonyms:CHEMBL2047856
TypeSmall organic molecule
Emp. Form.C9H9FN2O2
Mol. Mass.196.1784
SMILESN[C@H]1Cc2cccc(F)c2N(O)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: