Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine/alpha-aminoadipate aminotransferase, mitochondrial
LigandBDBM50386307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826598
IC50 174±n/a nM
Citation Dounay ABAnderson MBechle BMCampbell BMClaffey MMEvdokimov AEvrard EFonseca KRGan XGhosh SHayward MMHorner WKim JYMcAllister LAPandit JParadis VParikh VDReese MRRong SSalafia MASchuyten KStrick CATuttle JBValentine JWang HZawadzke LEVerhoest PR Discovery of Brain-Penetrant, Irreversible Kynurenine Aminotransferase II Inhibitors for Schizophrenia. ACS Med Chem Lett 3:187-192 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Name:Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Synonyms:2-aminoadipate aminotransferase | 2-aminoadipate transaminase | AADAT | Alpha-aminoadipate aminotransferase | KAT/AadAT | KAT2 | Kynurenine aminotransferase II | Kynurenine aminotransferase II (KAT II) | Kynurenine--oxoglutarate aminotransferase II | Kynurenine--oxoglutarate transaminase 2 | Kynurenine--oxoglutarate transaminase II
Type:Enzyme
Mol. Mass.:47353.09
Organism:Homo sapiens (Human)
Description:Q8N5Z0
Residue:425
Sequence:
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386307
n/a
NameBDBM50386307
Synonyms:CHEMBL2047860
TypeSmall organic molecule
Emp. Form.C10H9F3N2O2
Mol. Mass.246.1859
SMILESN[C@H]1Cc2cccc(c2N(O)C1=O)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: