Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50386349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_826696
Ki 55±n/a nM
Citation Rao AUShao NAslanian RGChan TYDegrado SJWang LMcKittrick BSenior MWest REWilliams SMWu RLHwa JPatel BZheng SSondey CPalani A Discovery of a potent thiadiazole class of histamine h3 receptor antagonist for the treatment of diabetes. ACS Med Chem Lett 3:198-202 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:PROTEIN
Mol. Mass.:48560.37
Organism:Mus musculus
Description:ChEMBL_988451
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50386349
n/a
NameBDBM50386349
Synonyms:CHEMBL2048591
TypeSmall organic molecule
Emp. Form.C22H32N6OS
Mol. Mass.428.594
SMILESOC1(CCCN(C1)c1nnc(s1)N1CCC(CC1)N1CCCCC1)c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: