| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50135800 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_827236 (CHEMBL2050635) |
|---|
| Ki | 1.9±n/a nM |
|---|
| Citation |  Neumeyer, JL; Zhang, B; Zhang, T; Sromek, AW; Knapp, BI; Cohen, DJ; Bidlack, JM Synthesis, binding affinity, and functional in vitro activity of 3-benzylaminomorphinan and 3-benzylaminomorphine ligands at opioid receptors. J Med Chem55:3878-90 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50135800 |
|---|
| n/a |
|---|
| Name | BDBM50135800 |
|---|
| Synonyms: | (-)-3-Hydroxy-N-cycloproypylmethylmorphinan Mandelate | 17-cyclopropylmethyl-(1R,9R,10R)-17-azatetracyclo[7.5.3.01,10.02,7]heptadeca-2(7),3,5-trien-4-ol | 3-Hydroxy-N-cyclopropylmethylmorphinan | CHEMBL49269 | CYCLORPHAN | US10231963, Table B.6 | US10736890, Compound TABLE B.6 | US11534436, Compound Table B.6 | US9656961, Example 00123 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27NO |
|---|
| Mol. Mass. | 297.4345 |
|---|
| SMILES | Oc1ccc2C[C@@H]3[C@@H]4CCCC[C@]4(CCN3CC3CC3)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
