| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50387298 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_828046 (CHEMBL2049740) |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Dakin, LA; Block, MH; Chen, H; Code, E; Dowling, JE; Feng, X; Ferguson, AD; Green, I; Hird, AW; Howard, T; Keeton, EK; Lamb, ML; Lyne, PD; Pollard, H; Read, J; Wu, AJ; Zhang, T; Zheng, X Discovery of novel benzylidene-1,3-thiazolidine-2,4-diones as potent and selective inhibitors of the PIM-1, PIM-2, and PIM-3 protein kinases. Bioorg Med Chem Lett22:4599-604 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50387298 |
|---|
| n/a |
|---|
| Name | BDBM50387298 |
|---|
| Synonyms: | CHEMBL2048872 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N3O2S |
|---|
| Mol. Mass. | 379.475 |
|---|
| SMILES | N[C@@H]1CCCN(C1)c1c(C=C2SC(O)=NC2=O)cccc1-c1ccccc1 |r,w:9.9,c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
