| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50046952 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_828209 (CHEMBL2050141) |
|---|
| Ki | 21.6±n/a nM |
|---|
| Citation |  Tu, Z; Wang, W; Cui, J; Zhang, X; Lu, X; Xu, J; Parsons, SM Synthesis and evaluation of in vitro bioactivity for vesicular acetylcholine transporter inhibitors containing two carbonyl groups. Bioorg Med Chem20:4422-9 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50046952 |
|---|
| n/a |
|---|
| Name | BDBM50046952 |
|---|
| Synonyms: | (3'R,4'R)-1'-(4-Fluoro-benzyl)-4-phenyl-[1,3']bipiperidinyl-4'-ol | CHEMBL129530 | CHEMBL1956464 | p-fluorobenzyltrozamicol | trans-1-(4-fluorobenzyl)-3-(4-phenylpiperidin-1-yl)piperidin-4-ol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H29FN2O |
|---|
| Mol. Mass. | 368.4876 |
|---|
| SMILES | O[C@@H]1CCN(Cc2ccc(F)cc2)C[C@H]1N1CCC(CC1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
