Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphoethanolamine N-methyltransferase
LigandBDBM50041457
Substrate/Competitorn/a
Meas. Tech.ChEMBL_829173
IC50 1350000±n/a nM
Citation Lee SGAlpert TDJez JM Crystal structure of phosphoethanolamine methyltransferase from Plasmodium falciparum in complex with amodiaquine. Bioorg Med Chem Lett 22:4990-3 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphoethanolamine N-methyltransferase
Name:Phosphoethanolamine N-methyltransferase
Synonyms:PMT
Type:PROTEIN
Mol. Mass.:31038.21
Organism:Plasmodium falciparum
Description:ChEMBL_829173
Residue:266
Sequence:
MTLIENLNSDKTFLENNQYTDEGVKVYEFIFGENYISSGGLEATKKILSDIELNENSKVL
DIGSGLGGGCMYINEKYGAHTHGIDICSNIVNMANERVSGNNKIIFEANDILTKEFPENN
FDLIYSRDAILHLSLENKNKLFQKCYKWLKPTGTLLITDYCATEKENWDDEFKEYVKQRK
YTLITVEEYADILTACNFKNVVSKDLSDYWNQLLEVEHKYLHENKEEFLKLFSEKKFISL
DDGWSRKIKDSKRKMQRWGYFKATKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041457
n/a
NameBDBM50041457
Synonyms:4-[(7-chloroquinolin-4-yl)amino]-2-[(diethylamino)methyl]phenol | AMODIAQUINE | CHEMBL682
TypeSmall organic molecule
Emp. Form.C20H22ClN3O
Mol. Mass.355.861
SMILESCCN(CC)Cc1cc(Nc2ccnc3cc(Cl)ccc23)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: