Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA Gyrase Subunit B
LigandBDBM50388097
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830517
IC50 9±n/a nM
Citation Manchester JIDussault DDRose JABoriack-Sjodin PAUria-Nickelsen MIoannidis GBist SFleming PHull KG Discovery of a novel azaindole class of antibacterial agents targeting the ATPase domains of DNA gyrase and Topoisomerase IV. Bioorg Med Chem Lett 22:5150-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA Gyrase Subunit B
Name:DNA gyrase
Synonyms:DNA gyrase subunit B (gyrB)
Type:Enzyme Subunit
Mol. Mass.:72530.91
Organism:Staphylococcus aureus
Description:n/a
Residue:644
Sequence:
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
GEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388097
n/a
NameBDBM50388097
Synonyms:CHEMBL2059375
TypeSmall organic molecule
Emp. Form.C20H16F3N7O2
Mol. Mass.443.3819
SMILESCCNC(=O)c1cc2c(c(cnc2[nH]1)-c1cncc(c1)C(N)=O)-n1ccc(n1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: