| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50388424 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_829916 (CHEMBL2061564) |
|---|
| Ki | 1.55±n/a nM |
|---|
| Citation |  Castellano, S; Taliani, S; Milite, C; Pugliesi, I; Da Pozzo, E; Rizzetto, E; Bendinelli, S; Costa, B; Cosconati, S; Greco, G; Novellino, E; Sbardella, G; Stefancich, G; Martini, C; Da Settimo, F Synthesis and biological evaluation of 4-phenylquinazoline-2-carboxamides designed as a novel class of potent ligands of the translocator protein. J Med Chem55:4506-10 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50388424 |
|---|
| n/a |
|---|
| Name | BDBM50388424 |
|---|
| Synonyms: | CHEMBL2059062 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20ClN3O |
|---|
| Mol. Mass. | 353.845 |
|---|
| SMILES | CC[C@@H](C)N(C)C(=O)c1nc(-c2ccccc2Cl)c2ccccc2n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
