Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2B
LigandBDBM7460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_830767
IC50 3000±n/a nM
Citation Wang REHunt CRChen JTaylor JS Biotinylated quercetin as an intrinsic photoaffinity proteomics probe for the identification of quercetin target proteins. Bioorg Med Chem 19:4710-20 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAMK2B
Name:CAMK2B
Synonyms:CaM kinase II | CaM kinase II beta | CaM kinase II subunit beta | CaM-kinase II beta chain | CaMK-II subunit beta | Calcium/calmodulin-dependent protein kinase type II | Calcium/calmodulin-dependent protein kinase type II beta chain
Type:Enzyme Catalytic Domain
Mol. Mass.:72685.48
Organism:Homo sapiens (Human)
Description:gi_26051204
Residue:666
Sequence:
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7460
n/a
NameBDBM7460
Synonyms:2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US9180183, Quercetin
TypeSmall organic molecule
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: