Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP |
---|
Ligand | BDBM50388968 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_833598 (CHEMBL2066539) |
---|
Ki | 410±n/a nM |
---|
Citation | Flygare, JA; Beresini, M; Budha, N; Chan, H; Chan, IT; Cheeti, S; Cohen, F; Deshayes, K; Doerner, K; Eckhardt, SG; Elliott, LO; Feng, B; Franklin, MC; Reisner, SF; Gazzard, L; Halladay, J; Hymowitz, SG; La, H; LoRusso, P; Maurer, B; Murray, L; Plise, E; Quan, C; Stephan, JP; Young, SG; Tom, J; Tsui, V; Um, J; Varfolomeev, E; Vucic, D; Wagner, AJ; Wallweber, HJ; Wang, L; Ware, J; Wen, Z; Wong, H; Wong, JM; Wong, M; Wong, S; Yu, R; Zobel, K; Fairbrother, WJ Discovery of a potent small-molecule antagonist of inhibitor of apoptosis (IAP) proteins and clinical candidate for the treatment of cancer (GDC-0152). J Med Chem55:4101-13 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP |
---|
Name: | E3 ubiquitin-protein ligase XIAP |
Synonyms: | API3 | BIRC4 | E3 ubiquitin-protein ligase XIAP | IAP3 | Inhibitor of apoptosis protein 3 | Inhibitor of apoptosis protein 3 (XIAP) | X-linked inhibitor of apoptosis | X-linked inhibitor of apoptosis protein (XIAP) | XIAP | XIAP_HUMAN |
Type: | Protein |
Mol. Mass.: | 56685.27 |
Organism: | Homo sapiens (Human) |
Description: | P98170 |
Residue: | 497 |
Sequence: | MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
|
|
|
BDBM50388968 |
---|
n/a |
---|
Name | BDBM50388968 |
Synonyms: | CHEMBL2063866 |
Type | Small organic molecule |
Emp. Form. | C31H42N4O3 |
Mol. Mass. | 518.6902 |
SMILES | CN[C@@H](C)C(=O)N[C@@H](C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)NCC(c1ccccc1)c1ccccc1 |r| |
Structure |
|