| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM21447 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_832857 (CHEMBL2066619) |
|---|
| IC50 | 2±n/a nM |
|---|
| Citation |  Zhou, H; Chen, J; Meagher, JL; Yang, CY; Aguilar, A; Liu, L; Bai, L; Cong, X; Cai, Q; Fang, X; Stuckey, JA; Wang, S Design of Bcl-2 and Bcl-xL inhibitors with subnanomolar binding affinities based upon a new scaffold. J Med Chem55:4664-82 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM21447 |
|---|
| n/a |
|---|
| Name | BDBM21447 |
|---|
| Synonyms: | 4-(4-{[2-(4-chlorophenyl)phenyl]methyl}piperazin-1-yl)-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]benzamide | ABT-737 | CHEMBL376408 | N-Benylpiperazine derivative, 2 | US11760752, Compound ABT-737 | US9125913, ABT-737 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H45ClN6O5S2 |
|---|
| Mol. Mass. | 813.427 |
|---|
| SMILES | CN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCN(Cc2ccccc2-c2ccc(Cl)cc2)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
