| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50423875 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_833115 (CHEMBL2067358) |
|---|
| Kd | 2.9±n/a nM |
|---|
| Citation |  Oberdorf, C; Schepmann, D; Vela, JM; Buschmann, H; Holenz, J; Wünsch, B Thiophene bioisosteres of spirocyclics receptor ligands: relationships between substitution pattern ands receptor affinity. J Med Chem55:5350-60 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50423875 |
|---|
| n/a |
|---|
| Name | BDBM50423875 |
|---|
| Synonyms: | (+)-[3H]-Pentazocine | CHEMBL2311194 | [3H]-(+)-Pentazocine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27NO |
|---|
| Mol. Mass. | 285.4238 |
|---|
| SMILES | [#6]-[#6@@H]1-[#6@@H]-2-[#6]-c3ccc(-[#8])cc3[C@@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:1:10.4.3| |
|---|
| Structure | 
|
|---|
Search and Browse
