Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase I delta
LigandBDBM50389320
Substrate/Competitorn/a
Meas. Tech.ChEMBL_831776
IC50<10000±n/a nM
Citation Maryanoff BEO'Neill JCMcComsey DFYabut SCLuci DKGibbs ACConnelly MA Pyrimidinopyrimidine inhibitors of ketohexokinase: exploring the ring C2 group that interacts with Asp-27B in the ligand binding pocket. Bioorg Med Chem Lett 22:5326-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase I delta
Name:CaM kinase I delta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42916.83
Organism:Homo sapiens (Human)
Description:ChEMBL_586559
Residue:385
Sequence:
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50389320
n/a
NameBDBM50389320
Synonyms:CHEMBL2063926
TypeSmall organic molecule
Emp. Form.C26H35N9S
Mol. Mass.505.681
SMILESCSc1ccccc1Nc1nc(nc2c(NCC3CC3)ncnc12)N1CCN(CC1)C1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: