Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmepsin 2
LigandBDBM50390633
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835449
Ki 2.3±n/a nM
Citation Vaiana NMarzahn MParapini SLiu PDell'Agli MPancotti ASangiovanni EBasilico NBosisio EDunn BMTaramelli DRomeo S Antiplasmodial activities of 4-aminoquinoline-statine compounds. Bioorg Med Chem Lett 22:5915-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Plasmepsin 2
Name:Plasmepsin 2
Synonyms:Aspartic hemoglobinase II | PFAPD | Plasmepsin 2 (PM-II) | Plasmepsin-II
Type:Enzyme
Mol. Mass.:51482.09
Organism:Plasmodium falciparum
Description:P46925
Residue:453
Sequence:
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390633
n/a
NameBDBM50390633
Synonyms:CHEMBL2069612
TypeSmall organic molecule
Emp. Form.C44H57ClN6O6
Mol. Mass.801.413
SMILESCCCCNC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)c1ccc(Oc2ccc(cc2)C(=O)NCCCNc2ccnc3cc(Cl)ccc23)cc1)[C@@H](C)CC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: