Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 1
LigandBDBM50390795
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835728
IC50 30±n/a nM
Citation He LSeitz SPTrainor GLTortolani DVaccaro WPoss MTarby CMTokarski JSPenhallow BHung CYAttar RLin TA Modulation of cofilin phosphorylation by inhibition of the Lim family kinases. Bioorg Med Chem Lett 22:5995-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 1
Name:LIM domain kinase 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:72591.81
Organism:Homo sapiens (Human)
Description:gi_4505001
Residue:647
Sequence:
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390795
n/a
NameBDBM50390795
Synonyms:CHEMBL2070619
TypeSmall organic molecule
Emp. Form.C20H14Cl2N6O2S
Mol. Mass.473.335
SMILESCOc1cc(Cl)c(c(Cl)c1)-c1cc(nc(n1)-c1cnccn1)-c1cnc(NC(C)=O)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: