Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity testis-specific protein kinase 1
LigandBDBM50390777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835731
IC50>30000±n/a nM
Citation He LSeitz SPTrainor GLTortolani DVaccaro WPoss MTarby CMTokarski JSPenhallow BHung CYAttar RLin TA Modulation of cofilin phosphorylation by inhibition of the Lim family kinases. Bioorg Med Chem Lett 22:5995-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity testis-specific protein kinase 1
Name:Dual specificity testis-specific protein kinase 1
Synonyms:TESK1
Type:PROTEIN
Mol. Mass.:67696.22
Organism:Homo sapiens (Human)
Description:ChEMBL_587103
Residue:626
Sequence:
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390777
n/a
NameBDBM50390777
Synonyms:CHEMBL2070495
TypeSmall organic molecule
Emp. Form.C25H27ClN6OS
Mol. Mass.495.039
SMILESCCCNc1ncc(s1)-c1cc(nc(n1)-c1cnccn1)-c1ccc(OC(CC)CC)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: