Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 2
LigandBDBM50390794
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835730
IC50 12±n/a nM
Citation He LSeitz SPTrainor GLTortolani DVaccaro WPoss MTarby CMTokarski JSPenhallow BHung CYAttar RLin TA Modulation of cofilin phosphorylation by inhibition of the Lim family kinases. Bioorg Med Chem Lett 22:5995-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 2
Name:LIM domain kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72238.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1514398
Residue:638
Sequence:
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390794
n/a
NameBDBM50390794
Synonyms:CHEMBL2070618
TypeSmall organic molecule
Emp. Form.C20H15Cl2N7O2S
Mol. Mass.488.35
SMILESCNC(=O)Nc1ncc(s1)-c1cc(nc(n1)-c1cnccn1)-c1c(Cl)cc(OC)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: