Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 1A2
LigandBDBM50370232
Substrate/Competitorn/a
Meas. Tech.ChEMBL_837096
Ki 51000±n/a nM
Citation Vavricka SRVan Montfoort JHa HRMeier PJFattinger K Interactions of rifamycin SV and rifampicin with organic anion uptake systems of human liver. Hepatology 36:164-72 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 1A2
Name:Solute carrier organic anion transporter family member 1A2
Synonyms:OATP | OATP-1 | OATP-A | OATP1 | OATP1A2 | Organic anion-transporting polypeptide 1 | SLC21A3 | SLCO1A2 | Sodium-independent organic anion transporter | Solute carrier family 21 member 3
Type:PROTEIN
Mol. Mass.:74140.62
Organism:Homo sapiens (Human)
Description:ChEMBL_837096
Residue:670
Sequence:
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370232
n/a
NameBDBM50370232
Synonyms:BA-41166E | L-5103 | RIFAMPIN | Rifadin | Rifampicin
TypeSmall organic molecule
Emp. Form.C43H58N4O12
Mol. Mass.822.9402
SMILESCO[C@H]1\C=C\O[C@@]2(C)Oc3c(C2=O)c2c(O)c(\C=N\N4CCN(C)CC4)c(NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@@H]1C)c(O)c2c(O)c3C |r,c:33,t:3,35|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: