Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOligopeptide transporter small intestine isoform
LigandBDBM50169125
Substrate/Competitorn/a
Meas. Tech.ChEMBL_835966
Ki 117000±n/a nM
Citation Ramamoorthy SLiu WMa YYYang-Feng TLGanapathy VLeibach FH Proton/peptide cotransporter (PEPT 2) from human kidney: functional characterization and chromosomal localization. Biochim Biophys Acta 1240:1-4 (1996) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Oligopeptide transporter small intestine isoform
Name:Oligopeptide transporter small intestine isoform
Synonyms:Intestinal H(+)/peptide cotransporter | Oligopeptide transporter, small intestine isoform | Peptide transporter 1
Type:PROTEIN
Mol. Mass.:78818.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488839
Residue:708
Sequence:
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169125
n/a
NameBDBM50169125
Synonyms:(S)-6-Amino-2-((S)-2-amino-propionylamino)-hexanoic acid | 6-Amino-2-(2-amino-propionylamino)-hexanoic acid | Ala-Lys | CHEMBL191057
TypeSmall organic molecule
Emp. Form.C9H19N3O3
Mol. Mass.217.2655
SMILESC[C@H](N)C(=O)N[C@@H](CCCCN)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: