Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCanalicular multispecific organic anion transporter 2
LigandBDBM50391004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_836618
Ki 83800±n/a nM
Citation Akita HSuzuki HHirohashi TTakikawa HSugiyama Y Transport activity of human MRP3 expressed in Sf9 cells: comparative studies with rat MRP3. Pharm Res 19:34-41 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Canalicular multispecific organic anion transporter 2
Name:Canalicular multispecific organic anion transporter 2
Synonyms:ATP-binding cassette sub-family C member 3 | Abcc3 | Cmoat2 | MLP-2 | MRP-like protein 2 | Mlp2 | Mrp3 | Multidrug resistance-associated protein 3
Type:PROTEIN
Mol. Mass.:168984.11
Organism:Rattus norvegicus
Description:ChEMBL_839340
Residue:1522
Sequence:
MDRLCGSGELGSKFWDSNLTVYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYLFYLRHHR
LGYIVLSCLSRLKTALGVLLWCISWVDLFYSFHGLVHGSSPAPVFFITPLLVGITMLLAT
LLIQYERLRGVRSSGVLIIFWLLCVICAIIPFRSKILLALAEGKILDPFRFTTFYIYFAL
VLCAFILSCFQEKPPLFSPENLDTNPCPEASAGFFSRLSFWWFTKLAILGYRRPLEDSDL
WSLSEEDCSHKVVQRLLEAWQKQQTQASGPQTAALEPKIAGEDEVLLKARPKTKKPSFLR
ALVRTFTSSLLMGACFKLIQDLSPSSTHSCSASSSGLFRPHGPYWWGFLLAGLMFVSSTM
QTLILHQHYHCIFVMALRIRTAIIGVIYRKALTITNSVKREYTVGEMVNLMSVDAQRFMD
VSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVQQMK
FKDSRIKLMSEILNGIKVLKLYAWEPTFLEQVEGIRQGELQLLRKGAYLQAISTFIWVCT
PFMVTLITLGVYVCVDKNNVLDAEKAFVSLSLFNILKIPLNLLPQLISGMTQTSVSLKRI
QDFLNQDELDPQCVERKTISPGRAITIHNGTFSWSKDLPPTLHSINIQIPKGALVAVVGP
VGCGKSSLVSALLGEMEKLEGAVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQ
ALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVD
SHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQITEMGHYSELLQHD
GSFANFLRNYAPDENQEANEGVLQHANEEVLLLEDTLSTHTDLTDTEPAIYEVRKQFMRE
MSSLSSEGEGQNRPVLKRYTSSLEKEVPATQTKETGALIKEEIAETGNVKLSVYWDYAKS
VGLCTTLFICLLYAGQNAVAIGANVWLSAWTNDVEEHGQQNNTSVRLGVYATLGILQGLL
VMLSAFTMVVGAIQAARLLHTALLHNQIRAPQSFFDTTPSGRILNRFSKDIYVIHEVLAP
TILMLFNSFYTSISTIVVIVASTPLFCVVVLPLAVFYGFVQRFYVATSRQLKRLESVSRS
PIFSHFSETVTGTSVIRAYGRVQDFKVLSDAKVDSNQKTTYPYIASNRWLGVHVEFVGNC
VVLFSALFAVIGRNSLNPGLVGLSVSYALQVTLSLNWMIRTLSDLESNIIAVERVKEYSK
TETEAPWVLESNRAPEGWPRSGVVEFRNYSVRYRPGLELVLKNLTLHVQGGEKVGIVGRT
GAGKSSMTLCLFRILEAAEGEIFIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLD
PFGRYSDEDIWRTLELSHLSAFVSSQPTGLDFQCSEGGDNLSVGQRQLVCLARALLRKSR
VLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFD
SPVNLIAAGGIFYGMAKDAGLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391004
n/a
NameBDBM50391004
Synonyms:CHEMBL213947
TypeSmall organic molecule
Emp. Form.C16H19N5O10S
Mol. Mass.473.415
SMILESN[C@@H](CCC(=O)N[C@H](CSc1ccc(cc1[N+]([O-])=O)[N+]([O-])=O)C(=O)NCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: