Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCanalicular multispecific organic anion transporter 1
LigandBDBM50391004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_836158
Ki 25800±n/a nM
Citation Ishizuka HKonno KNaganuma HSasahara KKawahara YNiinuma KSuzuki HSugiyama Y Temocaprilat, a novel angiotensin-converting enzyme inhibitor, is excreted in bile via an ATP-dependent active transporter (cMOAT) that is deficient in Eisai hyperbilirubinemic mutant rats (EHBR). J Pharmacol Exp Ther 280:1304-11 (1997) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Canalicular multispecific organic anion transporter 1
Name:Canalicular multispecific organic anion transporter 1
Synonyms:ATP-binding cassette sub-family C member 2 | Abcc2 | Canalicular multidrug resistance protein | Cmoat | Cmrp | Mrp2 | Multidrug resistance-associated protein 2
Type:PROTEIN
Mol. Mass.:173415.22
Organism:Rattus norvegicus
Description:ChEMBL_1455464
Residue:1541
Sequence:
MDKFCNSTFWDLSLLESPEADLPLCFEQTVLVWIPLGFLWLLAPWQLYSVYRSRTKRSSI
TKFYLAKQVFVVFLLILAAIDLSLALTEDTGQATVPPVRYTNPILYLCTWLLVLAVQHSR
QWCVRKNSWFLSLFWILSVLCGVFQFQTLIRALLKDSKSNMAYSYLFFVSYGFQIVLLIL
TAFSGPSDSTQTPSVTASFLSSITFSWYDRTVLKGYKHPLTLEDVWDIDEGFKTRSVTSK
FEAAMTKDLQKARQAFQRRLQKSQRKPEATLHGLNKKQSQSQDVLVLEEAKKKSEKTTKD
YPKSWLIKSLFKTFHVVILKSFILKLIHDLLVFLNPQLLKLLIGFVKSSNSYVWFGYICA
ILMFAVTLIQSFCLQSYFQHCFVLGMCVRTTVMSSIYKKALTLSNLARKQYTIGETVNLM
SVDSQKLMDATNYMQLVWSSVIQITLSIFFLWRELGPSILAGVGVMVLLIPVNGVLATKI
RNIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFQEQVQGIRKKELKNLLRFGQLQS
LLIFILQITPILVSVVTFSVYVLVDSANVLNAEKAFTSITLFNILRFPLSMLPMVTSSIL
QASVSVDRLERYLGGDDLDTSAIRRVSNFDKAVKFSEASFTWDPDLEATIQDVNLDIKPG
QLVAVVGTVGSGKSSLVSAMLGEMENVHGHITIQGSTAYVPQQSWIQNGTIKDNILFGSE
YNEKKYQQVLKACALLPDLEILPGGDMAEIGEKGINLSGGQKQRVSLARAAYQDADIYIL
DDPLSAVDAHVGKHIFNKVVGPNGLLAGKTRIFVTHGIHFLPQVDEIVVLGKGTILEKGS
YRDLLDKKGVFARNWKTFMKHSGPEGEATVNNDSEAEDDDDGLIPTMEEIPEDAASLAMR
RENSLRRTLSRSSRSSSRRGKSLKNSLKIKNVNVLKEKEKEVEGQKLIKKEFVETGKVKF
SIYLKYLQAVGWWSILFIILFYGLNNVAFIGSNLWLSAWTSDSDNLNGTNNSSSHRDMRI
GVFGALGLAQGICLLISTLWSIYACRNASKALHGQLLTNILRAPMRFFDTTPTGRIVNRF
SGDISTVDDLLPQTLRSWMMCFFGIAGTLVMICMATPVFAIIIIPLSILYISVQVFYVAT
SRQLRRLDSVTKSPIYSHFSETVTGLPIIRAFEHQQRFLAWNEKQIDINQKCVFSWITSN
RWLAIRLELVGNLVVFCSALLLVIYRKTLTGDVVGFVLSNALNITQTLNWLVRMTSEAET
NIVAVERISEYINVENEAPWVTDKRPPADWPRHGEIQFNNYQVRYRPELDLVLKGITCNI
KSGEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDVASIGLHDLRERLTIIPQDP
ILFSGSLRMNLDPFNKYSDEEVWRALELAHLRSFVSGLQLGLLSEVTEGGDNLSIGQRQL
LCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRKEFSQCTVITIAHRLHTIMDSDKI
MVLDNGKIVEYGSPEELLSNRGSFYLMAKEAGIENVNHTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391004
n/a
NameBDBM50391004
Synonyms:CHEMBL213947
TypeSmall organic molecule
Emp. Form.C16H19N5O10S
Mol. Mass.473.415
SMILESN[C@@H](CCC(=O)N[C@H](CSc1ccc(cc1[N+]([O-])=O)[N+]([O-])=O)C(=O)NCC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: