Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 4 |
---|
Ligand | BDBM50391065 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_841618 (CHEMBL2092044) |
---|
Ki | 19.95±n/a nM |
---|
Citation | Long, DD; Armstrong, SR; Beattie, DT; Choi, SK; Fatheree, PR; Gendron, RA; Genov, D; Goldblum, AA; Humphrey, PP; Jiang, L; Marquess, DG; Shaw, JP; Smith, JA; Turner, SD; Vickery, RG Discovery, oral pharmacokinetics and in vivo efficacy of velusetrag, a highly selective 5-HT(4) receptor agonist that has achieved proof-of-concept in patients with chronic idiopathic constipation. Bioorg Med Chem Lett22:6048-52 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 4 |
---|
Name: | 5-hydroxytryptamine receptor 4 |
Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
Type: | Enzyme |
Mol. Mass.: | 43767.54 |
Organism: | Homo sapiens (Human) |
Description: | Q13639 |
Residue: | 388 |
Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
BDBM50391065 |
---|
n/a |
---|
Name | BDBM50391065 |
Synonyms: | CHEMBL2087336 |
Type | Small organic molecule |
Emp. Form. | C25H36N4O5S |
Mol. Mass. | 504.642 |
SMILES | CC(C)n1c2ccccc2cc(C(=O)N[C@@H]2C[C@@H]3CC[C@H](C2)N3C[C@H](O)CN(C)S(C)(=O)=O)c1=O |r,THB:23:22:15.21.16:19.18| |
Structure |
|