Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenal Outer Medullary Potassium (ROMK)
LigandBDBM50391781
Substrate/Competitorn/a
Meas. Tech.ChEMBL_849893
IC50 55±n/a nM
Citation Tang HWalsh SPYan Yde Jesus RKShahripour ATeumelsan NZhu YHa SOwens KAThomas-Fowlkes BSFelix JPLiu JKohler MPriest BTBailey TBrochu RAlonso-Galicia MKaczorowski GJRoy SYang LMills SGGarcia MLPasternak A Discovery of Selective Small Molecule ROMK Inhibitors as Potential New Mechanism Diuretics. ACS Med Chem Lett 3:367-372 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renal Outer Medullary Potassium (ROMK)
Name:Renal Outer Medullary Potassium (ROMK)
Synonyms:ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1)
Type:Enzyme
Mol. Mass.:44976.27
Organism:Rattus norvegicus (Rat)
Description:P35560
Residue:391
Sequence:
MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391781
n/a
NameBDBM50391781
Synonyms:CHEMBL2146873 | US9073882, 38
TypeSmall organic molecule
Emp. Form.C23H24FN3O2
Mol. Mass.393.454
SMILESFc1cc(CCN2CCN(CCc3ccc4C(=O)OCc4c3)CC2)ccc1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: