Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50392708
Substrate/Competitorn/a
Meas. Tech.ChEMBL_854283
EC50 749±n/a nM
Citation Gembus VFurman CMillet RMansouri RChavatte PLevacher VBrière JF Scaffold hopping strategy toward original pyrazolines as selective CB2 receptor ligands. Eur J Med Chem 58:396-404 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392708
n/a
NameBDBM50392708
Synonyms:CHEMBL2151377
TypeSmall organic molecule
Emp. Form.C28H34ClN3O
Mol. Mass.464.042
SMILESCc1cc(ccc1Cl)C1=NN(CC1Cc1ccccc1)C(=O)NC1C(C)(C)C2CCC1(C)C2 |t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: