Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target72 kDa type IV collagenase
LigandBDBM50215926
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853829
IC50 1.7±n/a nM
Citation Shengule SRLoa-Kum-Cheung WLParish CRBlairvacq MMeijer LNakao YKaruso P A one-pot synthesis and biological activity of ageladine A and analogues. J Med Chem 54:2492-503 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
72 kDa type IV collagenase
Name:72 kDa type IV collagenase
Synonyms:72 kDa gelatinase | 72 kDa type IV collagenase precursor | Gelatinase A | Gelatinase A (MMP-2) | Matrix metalloproteinase-2 | Matrix metalloproteinase-2 (MMP 2) | Matrix metalloproteinase-2 (MMP2) | Matrix metalloproteinases 2 (MMP-2) | TBE-1
Type:Enzyme
Mol. Mass.:73870.36
Organism:Homo sapiens (Human)
Description:
Residue:660
Sequence:
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215926
n/a
NameBDBM50215926
Synonyms:4-(4,5-dibromo-1H-pyrrol-2-yl)-1H-imidazo[4,5-c]pyridin-2-amine | Ageladine A | CHEMBL230806
TypeSmall organic molecule
Emp. Form.C10H7Br2N5
Mol. Mass.357.004
SMILESNc1nc2c(nccc2[nH]1)-c1cc(Br)c(Br)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: