Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAP2-associated protein kinase 1
LigandBDBM50393109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853854
Kd 1500±n/a nM
Citation Shengule SRLoa-Kum-Cheung WLParish CRBlairvacq MMeijer LNakao YKaruso P A one-pot synthesis and biological activity of ageladine A and analogues. J Med Chem 54:2492-503 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AP2-associated protein kinase 1
Name:AP2-associated protein kinase 1
Synonyms:AAK1 | Adaptor-associated kinase 1 | KIAA1048
Type:PROTEIN
Mol. Mass.:103884.23
Organism:Homo sapiens (Human)
Description:ChEMBL_774569
Residue:961
Sequence:
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393109
n/a
NameBDBM50393109
Synonyms:CHEMBL2153264
TypeSmall organic molecule
Emp. Form.C11H9N5
Mol. Mass.211.2227
SMILESNc1nc2c(nccc2[nH]1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: