Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase II
LigandBDBM50393109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853856
Kd 40000±n/a nM
Citation Shengule SRLoa-Kum-Cheung WLParish CRBlairvacq MMeijer LNakao YKaruso P A one-pot synthesis and biological activity of ageladine A and analogues. J Med Chem 54:2492-503 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase II
Name:CaM kinase II
Synonyms:CaM kinase II gamma | Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMKllg)
Type:Protein
Mol. Mass.:62621.56
Organism:Homo sapiens (Human)
Description:Q13555
Residue:558
Sequence:
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPL
QTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSL
CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFE
NLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDG
KWLNVHYHCSGAPAAPLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393109
n/a
NameBDBM50393109
Synonyms:CHEMBL2153264
TypeSmall organic molecule
Emp. Form.C11H9N5
Mol. Mass.211.2227
SMILESNc1nc2c(nccc2[nH]1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: