Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 1
LigandBDBM50393109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_853868
Kd 530±n/a nM
Citation Shengule SRLoa-Kum-Cheung WLParish CRBlairvacq MMeijer LNakao YKaruso P A one-pot synthesis and biological activity of ageladine A and analogues. J Med Chem 54:2492-503 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha 1
Name:Ribosomal protein S6 kinase alpha 1
Synonyms:90 kDa ribosomal protein S6 kinase 1 | MAP kinase-activated protein kinase 1a | MAPKAPK1A | RPS6KA1(Kin.Dom.1 - N-terminal) | RPS6KA1(Kin.Dom.2 - C-terminal) | RSK-1 | Ribosomal S6 Kinase 1 (RSK-1) | Ribosomal S6 kinase 1 | Ribosomal S6 kinase 1 (RSK1) | Ribosomal protein S6 kinase alpha-1 | Ribosomal protein S6 kinase alpha-1 (RSK1) | S6K-alpha 1 | p90-RSK 1 | p90S6K | pp90RSK1
Type:Serine/threonine-protein kinase
Mol. Mass.:82736.10
Organism:Homo sapiens (Human)
Description:n/a
Residue:735
Sequence:
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393109
n/a
NameBDBM50393109
Synonyms:CHEMBL2153264
TypeSmall organic molecule
Emp. Form.C11H9N5
Mol. Mass.211.2227
SMILESNc1nc2c(nccc2[nH]1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: