Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMultidrug and toxin extrusion protein 2
LigandBDBM50062614
Substrate/Competitorn/a
Meas. Tech.ChEMBL_852940
IC50>100000±n/a nM
Citation Kido YMatsson PGiacomini KM Profiling of a prescription drug library for potential renal drug-drug interactions mediated by the organic cation transporter 2. J Med Chem 54:4548-58 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Multidrug and toxin extrusion protein 2
Name:Multidrug and toxin extrusion protein 2
Synonyms:Kidney-specific H(+)/organic cation antiporter | MATE-2 | MATE2 | SLC47A2 | Solute carrier family 47 member 2 | hMATE-2
Type:PROTEIN
Mol. Mass.:65098.38
Organism:Homo sapiens (Human)
Description:ChEMBL_934314
Residue:602
Sequence:
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
RH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062614
n/a
NameBDBM50062614
Synonyms:CHEMBL900 | Dimethyl-[2-(phenyl-o-tolyl-methoxy)-ethyl]-amine | Disipal | Invagesic | N,N-dimethyl-2-(phenyl(o-tolyl)methoxy)ethanamine | Norflex | Norgesic | ORPHENADRINE | Orphengesic
TypeSmall organic molecule
Emp. Form.C18H23NO
Mol. Mass.269.3813
SMILESCN(C)CCOC(c1ccccc1)c1ccccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: