| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM50393493 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_855971 (CHEMBL2161972) |
|---|
| IC50 | 15000±n/a nM |
|---|
| Citation |  Stanford, SM; Krishnamurthy, D; Falk, MD; Messina, R; Debnath, B; Li, S; Liu, T; Kazemi, R; Dahl, R; He, Y; Yu, X; Chan, AC; Zhang, ZY; Barrios, AM; Woods, VL; Neamati, N; Bottini, N Discovery of a novel series of inhibitors of lymphoid tyrosine phosphatase with activity in human T cells. J Med Chem54:1640-54 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM50393493 |
|---|
| n/a |
|---|
| Name | BDBM50393493 |
|---|
| Synonyms: | CHEMBL2159934 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19N3O2S |
|---|
| Mol. Mass. | 377.459 |
|---|
| SMILES | COc1ccc2cc(C#N)c(SCC(=O)Nc3cccc(C)c3C)nc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
