| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50393500 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_855961 (CHEMBL2161835) |
|---|
| IC50 | 45300±n/a nM |
|---|
| Citation |  Stanford, SM; Krishnamurthy, D; Falk, MD; Messina, R; Debnath, B; Li, S; Liu, T; Kazemi, R; Dahl, R; He, Y; Yu, X; Chan, AC; Zhang, ZY; Barrios, AM; Woods, VL; Neamati, N; Bottini, N Discovery of a novel series of inhibitors of lymphoid tyrosine phosphatase with activity in human T cells. J Med Chem54:1640-54 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM50393500 |
|---|
| n/a |
|---|
| Name | BDBM50393500 |
|---|
| Synonyms: | CHEMBL2159726 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N3OS |
|---|
| Mol. Mass. | 353.481 |
|---|
| SMILES | Cc1ccc2cc(C#N)c(SCC(=O)NC3CCCCC3)nc2c1C |
|---|
| Structure | 
|
|---|
Search and Browse
