Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBaculoviral IAP repeat-containing protein 2
LigandBDBM50393507
Substrate/Competitorn/a
Meas. Tech.ChEMBL_856200
Ki<1±n/a nM
Citation Cai QSun HPeng YLu JNikolovska-Coleska ZMcEachern DLiu LQiu SYang CYMiller RYi HZhang TSun DKang SGuo MLeopold LYang DWang S A potent and orally active antagonist (SM-406/AT-406) of multiple inhibitor of apoptosis proteins (IAPs) in clinical development for cancer treatment. J Med Chem 54:2714-26 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Baculoviral IAP repeat-containing protein 2
Name:Baculoviral IAP repeat-containing protein 2
Synonyms:Baculoviral IAP repeat-containing protein 2 (cIAP1) | Cellular inhibitor of apoptosis 1 | Inhibitor of apoptosis protein 2 (cIAP1)
Type:Protein
Mol. Mass.:69900.47
Organism:Homo sapiens (Human)
Description:Q13490
Residue:618
Sequence:
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393507
n/a
NameBDBM50393507
Synonyms:CHEMBL2158053
TypeSmall organic molecule
Emp. Form.C54H86N12O7S
Mol. Mass.1047.402
SMILESCN[C@@H](C)C(=O)N[C@H]1CN(CC[C@H]2CC[C@H](N2C1=O)C(=O)N[C@H](c1cn(CCCCCCCCCCNC(=O)CCCCCNC(=O)CCCC[C@@H]2SC[C@@H]3NC(=O)N[C@H]23)nn1)c1ccccc1)C(=O)CC(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: