Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 2B1
LigandBDBM22984
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860288
IC50 240000±n/a nM
Citation Karlgren MVildhede ANorinder UWisniewski JRKimoto ELai YHaglund UArtursson P Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem 55:4740-63 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 2B1
Name:Solute carrier organic anion transporter family member 2B1
Synonyms:KIAA0880 | OATP-B | OATP-RP2 | OATP2B1 | OATPB | OATPRP2 | Organic anion transporter B | Organic anion transporter polypeptide-related protein 2 | SLC21A9 | SLCO2B1 | Solute carrier family 21 member 9
Type:PROTEIN
Mol. Mass.:76729.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1488531
Residue:709
Sequence:
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22984
n/a
NameBDBM22984
Synonyms:(8S,10S)-10-{[(2R,4S,5S,6S)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy}-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione | Adriamycin | Adriblastina | CHEMBL53463 | Doxil | Doxorubicin
TypeAntibiotic
Emp. Form.C27H29NO11
Mol. Mass.543.5193
SMILESCOc1cccc2C(=O)c3c(O)c4C[C@](O)(C[C@H](O[C@H]5C[C@H](N)[C@H](O)[C@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: