Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 1B1 (OATP1B1)
LigandBDBM20688
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860286
Ki 3400±n/a nM
Citation Karlgren MVildhede ANorinder UWisniewski JRKimoto ELai YHaglund UArtursson P Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem 55:4740-63 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Name:Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Synonyms:Solute carrier organic anion transporter family member 1B1 | Thromboxane B2
Type:Protein
Mol. Mass.:76468.06
Organism:Homo sapiens (Human)
Description:Q9Y6L6
Residue:691
Sequence:
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20688
n/a
NameBDBM20688
Synonyms:(3R,5R)-7-[(1S,2S,6S,8S,8aR)-6-hydroxy-2-methyl-8-{[(2S)-2-methylbutanoyl]oxy}-1,2,6,7,8,8a-hexahydronaphthalen-1-yl]-3,5-dihydroxyheptanoic acid | CHEMBL1144 | Pravastatin
TypeSmall organic molecule
Emp. Form.C23H36O7
Mol. Mass.424.5277
SMILES[H][C@]12[C@H](C[C@H](O)C=C1C=C[C@H](C)[C@@H]2CC[C@@H](O)C[C@@H](O)CC(O)=O)OC(=O)[C@@H](C)CC |r,c:6,9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: