Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier organic anion transporter family member 1B1 (OATP1B1)
LigandBDBM17638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860286
Ki 11000±n/a nM
Citation Karlgren MVildhede ANorinder UWisniewski JRKimoto ELai YHaglund UArtursson P Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem 55:4740-63 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Name:Solute carrier organic anion transporter family member 1B1 (OATP1B1)
Synonyms:Solute carrier organic anion transporter family member 1B1 | Thromboxane B2
Type:Protein
Mol. Mass.:76468.06
Organism:Homo sapiens (Human)
Description:Q9Y6L6
Residue:691
Sequence:
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
NGSVMDEANLESLNKNKHFVPSAGADSETHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17638
n/a
NameBDBM17638
Synonyms:2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US9271961, Indomethacin | indometacin
TypeSmall organic molecule
Emp. Form.C19H16ClNO4
Mol. Mass.357.788
SMILESCOc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: