Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone lysine demethylase PHF8
LigandBDBM50395076
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859445
IC50 550±n/a nM
Citation Rose NRWoon ECTumber AWalport LJChowdhury RLi XSKing ONLejeune CNg SSKrojer TChan MCRydzik AMHopkinson RJChe KHDaniel MStrain-Damerell CGileadi CKochan GLeung IKDunford JYeoh KKRatcliffe PJBurgess-Brown Nvon Delft FMuller SMarsden BBrennan PEMcDonough MAOppermann UKlose RJSchofield CJKawamura A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem 55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone lysine demethylase PHF8
Name:Histone lysine demethylase PHF8
Synonyms:Histone lysine demethylase PHF8 (PHF8) | Lysine-specific demethylase 7A/7B | PHD finger protein 8
Type:Protein
Mol. Mass.:117889.91
Organism:Homo sapiens (Human)
Description:Q9UPP1
Residue:1060
Sequence:
MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECD
MCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGS
PTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTV
RDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLV
ETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEK
IFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTP
VDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIF
QQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKA
ERKGKESSALGPAGQLSYNLMDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDG
NESPLALLMSNGSTKRVKSLSKSRRTKIAKKVDKARLMAEQVMEDEFDLDSDDELQIDER
LGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGN
GSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQ
AWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
RVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAA
TPQLVTSSSPLPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRP
SVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395076
n/a
NameBDBM50395076
Synonyms:CHEMBL2164243
TypeSmall organic molecule
Emp. Form.C6H12N2O3
Mol. Mass.160.1711
SMILESCN(C)NC(=O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: