Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomo sapiens lysine demethylase 2A (KDM2A)
LigandBDBM50395077
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859444
IC50>100000±n/a nM
Citation Rose NRWoon ECTumber AWalport LJChowdhury RLi XSKing ONLejeune CNg SSKrojer TChan MCRydzik AMHopkinson RJChe KHDaniel MStrain-Damerell CGileadi CKochan GLeung IKDunford JYeoh KKRatcliffe PJBurgess-Brown Nvon Delft FMuller SMarsden BBrennan PEMcDonough MAOppermann UKlose RJSchofield CJKawamura A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem 55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Homo sapiens lysine demethylase 2A (KDM2A)
Name:Homo sapiens lysine demethylase 2A (KDM2A)
Synonyms:AA1-1162 | F-box and leucine-rich repeat protein 11 | FBXL11 | Lysine-specific demethylase 2A | Lysine-specific demethylase 2A (KDM2A) | NM_012308
Type:Enzyme Catalytic Domain
Mol. Mass.:132809.04
Organism:Homo sapiens (Human)
Description:n/a
Residue:1162
Sequence:
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395077
n/a
NameBDBM50395077
Synonyms:CHEMBL2164250
TypeSmall organic molecule
Emp. Form.C8H18N4O2
Mol. Mass.202.2541
SMILESCN(C)NC(=O)CCC(=O)NN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: