Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHypoxia-inducible factor 1 (FIH)
LigandBDBM50395080
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859437
IC50>100000±n/a nM
Citation Rose NRWoon ECTumber AWalport LJChowdhury RLi XSKing ONLejeune CNg SSKrojer TChan MCRydzik AMHopkinson RJChe KHDaniel MStrain-Damerell CGileadi CKochan GLeung IKDunford JYeoh KKRatcliffe PJBurgess-Brown Nvon Delft FMuller SMarsden BBrennan PEMcDonough MAOppermann UKlose RJSchofield CJKawamura A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem 55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hypoxia-inducible factor 1 (FIH)
Name:Hypoxia-inducible factor 1 (FIH)
Synonyms:Hypoxia-inducible factor 1-alpha inhibitor
Type:Enzyme
Mol. Mass.:40278.92
Organism:Homo sapiens (Human)
Description:Q9NWT6
Residue:349
Sequence:
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE
PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR
EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG
QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS
QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395080
n/a
NameBDBM50395080
Synonyms:CHEMBL2164249
TypeSmall organic molecule
Emp. Form.C6H11NO4
Mol. Mass.161.1558
SMILESCN(C)OC(=O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: