Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 1
LigandBDBM50129197
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859438
IC50 19600±n/a nM
Citation Rose NRWoon ECTumber AWalport LJChowdhury RLi XSKing ONLejeune CNg SSKrojer TChan MCRydzik AMHopkinson RJChe KHDaniel MStrain-Damerell CGileadi CKochan GLeung IKDunford JYeoh KKRatcliffe PJBurgess-Brown Nvon Delft FMuller SMarsden BBrennan PEMcDonough MAOppermann UKlose RJSchofield CJKawamura A Plant growth regulator daminozide is a selective inhibitor of human KDM2/7 histone demethylases. J Med Chem 55:6639-43 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 1
Name:Egl nine homolog 1
Synonyms:Egl nine homolog 1 (EGLIN1) | Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129197
n/a
NameBDBM50129197
Synonyms:4-(Hydroxyamino)-4-oxobutanoic acid | CHEMBL51979 | N-Hydroxy-succinamic acid
TypeSmall organic molecule
Emp. Form.C4H7NO4
Mol. Mass.133.1027
SMILESONC(=O)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: