Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50395162
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859789
IC50 1.53±n/a nM
Citation Baraldi PGSaponaro GMoorman ARRomagnoli RPreti DBaraldi SRuggiero EVarani KTarga MVincenzi FBorea PAAghazadeh Tabrizi M 7-Oxo-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxamides as selective CB(2) cannabinoid receptor ligands: structural investigations around a novel class of full agonists. J Med Chem 55:6608-23 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395162
n/a
NameBDBM50395162
Synonyms:CHEMBL2163935
TypeSmall organic molecule
Emp. Form.C21H26N2O3
Mol. Mass.354.4427
SMILESCCCC1COc2cccc3c2n1cc(C(=O)NC1CCCCC1)c3=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: